LL-37 (Human Cathelicidin)

Comprehensive Research Analysis - Antimicrobial Peptide with Immunomodulatory & Wound Healing Properties

Classification: Antimicrobial Peptide (AMP), Cathelicidin-Derived, Immune Modulator Amino Acid Sequence: [LL-37, 37 aa] (37 amino acids) Chemical Formula: C₂₀₇H₃₄₀N₆₀O₅₃ Molecular Weight: 4,493 Da (~4.5 kDa) Research Status: Phase I/II Clinical Trials (wound healing) WADA Status: No specific prohibition

1. Executive Summary

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans, a 37-residue, amphipathic, helical peptide with broad-spectrum antimicrobial and immunomodulatory properties. The name "LL-37" derives from the two leucine (LL) residues at the N-terminus and its 37-amino-acid length. LL-37 is derived from the C-terminal end of human cathelicidin antimicrobial protein (hCAP-18).

Dual Mechanism: LL-37 functions both as a direct antimicrobial agent via membrane disruption and as an immune modulator via membrane-mediated receptor interactions. Primary mechanism is membrane disruption through transmembrane pore formation, causing bacterial cell lysis. Additionally, LL-37 regulates inflammatory response, chemoattracts adaptive immune cells, neutralizes LPS, and promotes wound re-epithelialization.

Broad Spectrum: LL-37 effectively combats over 38 bacteria, 16 fungi, and 16 viruses through membrane rupture, biofilm suppression, and intracellular targeting.

Clinical Evidence: Randomized controlled trial demonstrated topical LL-37 (0.5 mg/mL) reduced venous leg ulcer area by 68% over 4 weeks with no safety concerns and excellent tolerability.

Goal Relevance:

• Speed up wound healing and recovery from cuts or ulcers
• Boost immune system to fight off infections and reduce inflammation
• Support recovery from bacterial, fungal, or viral infections, including antibiotic-resistant strains
• Improve skin health and promote healing of skin conditions
• Enhance recovery from respiratory infections and support lung health

2. Chemical Structure & Composition

Molecular Weight: 4,493 Da (~4.5 kDa) Formula: C₂₀₇H₃₄₀N₆₀O₅₃

Amino Acid Sequence (37 residues): [LL-37, 37 aa]

N-terminus: LL (two leucine residues) C-terminus: ES (glutamic acid-serine) Net Charge: +6 (cationic peptide)

Structural Characteristics

α-Helical Amphipathic Structure:

• Contains characteristic amphipathic helix
• Hydrophobic and hydrophilic residues arranged on opposite faces of helix
• Enables membrane interaction and insertion

Oligomerization & Channel Formation: LL-37 shows oligomerization and channel formation in presence of membrane mimics, creating discrete membrane lesions (pores) leading to cell lysis.

Derivation: Cleaved from C-terminal end of 18-kDa precursor protein hCAP-18 (human cationic antimicrobial protein of 18 kDa).

Expression Sites: Expressed in epithelial cells of testis, skin, GI tract, respiratory tract, and leukocytes (monocytes, neutrophils, T cells, NK cells, B cells).

3. Mechanism of Action

Primary Antimicrobial Mechanism: Membrane Disruption

Pore-Forming Activity:

1. Electrostatic Attraction: Net +6 charge binds to negatively charged bacterial membranes
2. Membrane Insertion: Amphipathic helix inserts into lipid bilayer
3. Oligomerization: Forms oligomeric structures creating transmembrane pores
4. Cell Lysis: Disruption of cell integrity leads to lysis and death

Intracellular Targeting: LL-37 can permeate cell membrane to interact with intracellular targets (e.g., acyl carrier proteins).

Biofilm Suppression: Disrupts biofilm formation and destroys established biofilms.

Immunomodulatory Functions

Inflammation Regulation:

• Suppresses inflammatory response induced by TLR2 and TLR4 activation
• Binds and neutralizes LPS and LTA, preventing TLR agonist binding
• Prevents severe inflammatory responses

Chemotaxis: Chemoattracts cells of adaptive immune system to wound or infection sites

Wound Healing Promotion:

• Promotes re-epithelialization
• Enhances wound closure
• Increases vascularization in animal studies

Broad-Spectrum Antimicrobial Activity

Comprehensive Coverage:

• Bacteria: >38 species (including MRSA, antibiotic-resistant strains)
• Fungi: 16 species
• Viruses: 16 species

Mechanisms:

• Membrane rupture
• Intracellular targeting
• Biofilm suppression

Clinical Relevance

Role in COVID-19: Upregulating LL-37 expression may prevent severe COVID-19 inflammatory responses and reduce microthrombosis.

Dual Nature: Functions as both pore-forming antibacterial peptide AND host-cell modulator.

4. Pharmacokinetics

Half-Life & Degradation

Intracellular Half-Life:

• ~1 hour in cell culture (BEAS-2B cells)
• >12 hours when endosome acidification inhibited
• Implication: Endosome acidification leads to proteolytic degradation

Systemic Pharmacokinetics: Limited published data on plasma half-life, bioavailability, clearance, and volume of distribution in humans. LL-37 is in Phase I/II clinical trials, and comprehensive human PK studies may not yet be publicly available.

Bioavailability Considerations

Route-Dependent:

• Topical: Local action at application site
• Subcutaneous: Systemic absorption (data limited)
• Oral: Exploratory COVID-19 trial used oral capsules (specific doses/bioavailability undisclosed)

Stability: Peptide structure subject to proteolytic degradation; requires proper formulation for therapeutic use.

5. Dosing Protocols

Topical Application (Clinical Trial - Wound Healing)

RCT Protocol - Venous Leg Ulcers (N=34):

• Concentrations: 0.5, 1.6, 3.2 mg/mL
• Application: 25 μL per cm² of target area
• Frequency: Twice weekly
• Duration: 4 weeks

Outcomes:

• 0.5 mg/mL: 68% mean ulcer area reduction
• 1.6 mg/mL: 50% mean ulcer area reduction
• 3.2 mg/mL: No difference vs placebo
• Conclusion: Lower concentrations more effective; higher doses associated with local reactions without added benefit

Subcutaneous Administration (Investigational - Non-Standardized)

Research/Clinical Protocols:

• Dose Range: 100-200 mcg per injection
• Frequency: 1-3 times per week
• Alternative: 50-125 mcg daily, sometimes divided into two 50-60 mcg doses
• Weight-Based: 50 mcg/kg body weight per day

Cycling Recommendation: Continuous treatment at maximum doses should not exceed 3 months; use 2-4 week breaks between active treatment periods.

Oral Administration (Exploratory)

COVID-19 Study:

• Oral capsule formulation
• Specific doses NOT disclosed
• 11 participants, no adverse reactions reported

Administration Guidelines

Topical:

• Apply directly to wound/infection site
• Clean area before application
• Cover with sterile dressing if appropriate

Subcutaneous:

• Reconstitute lyophilized powder with bacteriostatic water
• Inject into abdomen, thigh (rotate sites)
• Use insulin syringes
• Start with lower doses and monitor response

Safety Note: High doses (≥300 mcg/day) can cause severe injection site irritation, flu-like symptoms, or gut disruption

6. Clinical Research & Evidence

Wound Healing - RCT

Randomized, Placebo-Controlled Trial - Hard-to-Heal Venous Leg Ulcers:

• N=34 participants
• Duration: 4 weeks
• Doses: 0.5, 1.6, 3.2 mg/mL topical
• Application: 25 μL/cm² twice weekly

Results:

• 0.5 mg/mL: 68% ulcer area reduction
• 1.6 mg/mL: 50% ulcer area reduction
• 3.2 mg/mL: No benefit vs placebo (higher local reactions)
• Safety: No local or systemic adverse events; safe and well-tolerated

Conclusion: Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers.

COVID-19 Exploratory Study

Small-Scale Single-Arm Safety Study:

• N=11 participants
• Route: Oral capsule
• Safety: No adverse reactions reported
• Efficacy: Preliminary evaluation only

Antimicrobial Activity - In Vitro & Preclinical

Broad-Spectrum Activity:

• Effective against >38 bacteria, 16 fungi, 16 viruses
• Inhibits MRSA and antibiotic-resistant strains

Oral/Respiratory Pathogens: Antibacterial activity against bacteria associated with oral and upper respiratory tract infections

Staphylococcus aureus: Effective against both extra- and intracellular S. aureus

Animal Studies - Wound Healing

Preclinical Wound Healing:

• Topical synthetic and recombinant LL-37 increased vascularization
• Enhanced re-epithelialization

Nanocarrier Delivery: Lipidized LL-37-loaded PLGA nanocarriers demonstrate bioengineered peptide delivery for enhanced wound healing

Preclinical Safety

Three-Week Rat Study: No adverse effects on body weight, food/water intake, hematological or serum biochemical parameters

7. Safety Profile

Clinical Trial Safety

Excellent Tolerability:

• Topical RCT: No safety concerns regarding local or systemic adverse events
• Oral COVID-19 study: No adverse reactions in 11 participants
• Preclinical: No adverse effects in 3-week rat administration

Common Side Effects (Subcutaneous Use)

Injection Site Reactions:

• Redness and swelling at injection sites (common)
• Irritation or inflammation

Dose-Dependent Effects:

• High doses (≥300 mcg/day):
  • Severe injection site irritation
  • Flu-like symptoms
  • Gut disruption

Clinical Considerations

Psoriasis Caveat: In psoriasis, elevated LL-37 levels (up to 300 µM) observed, which can contribute to tissue damage. Caution warranted in patients with inflammatory skin conditions.

Concentration-Dependent Toxicity: High concentrations may cause inflammation or cellular damage at application/injection sites.

Systemic Inflammatory Responses: Potential for systemic inflammatory responses with inappropriate dosing

Safety Recommendations

Dosing Strategy:

• Start with lower doses and monitor response
• Use cycles with 2-4 week washout periods
• Do not exceed 3 months continuous treatment at maximum doses

Monitoring:

• Monitor injection sites for reactions
• Watch for flu-like symptoms
• Assess wound healing progress (topical)

Topical Safety: Lower concentrations (0.5-1.6 mg/mL) more effective and better tolerated than high concentrations

Overall Assessment

Clinical Profile: Safe and well-tolerated in controlled clinical settings

Research Use: Favorable preclinical and early clinical safety profile; appropriate for investigational use with medical supervision

8. Administration & Practical Application

Routes: Topical (clinical), subcutaneous (investigational), oral (exploratory) Sites (SC): Abdomen, thigh (rotate sites) Reconstitution (SC): Bacteriostatic water for lyophilized powder Injection Technique:

• Insulin syringes
• Alcohol swab injection site
• Inject slowly
• Rotate sites to prevent irritation

Topical Application Protocol

Wound Healing:

• Clean wound area thoroughly
• Apply 25 μL per cm² of target area
• Use 0.5-1.6 mg/mL concentration
• Apply twice weekly
• Cover with sterile dressing if appropriate
• Monitor healing progress

Subcutaneous Protocol

Investigational Dosing:

• Reconstitute lyophilized powder
• Draw dose (typically 100-200 mcg)
• Inject SC into abdomen or thigh
• Frequency: 1-3× per week
• Cycle: 8-12 weeks on, 2-4 weeks off

Starting Approach: Begin at lower end of range (100 mcg) and assess tolerability before increasing

Storage & Handling

Lyophilized Powder:

• Store -20°C (freezer) long-term
• 2-8°C (refrigerator) short-term acceptable
• Protect from light and moisture

Reconstituted Solution:

• Refrigerate 2-8°C
• Use within 14-30 days
• Do NOT freeze
• Protect from light

Topical Formulation:

• Follow manufacturer storage guidelines
• Typically refrigerated
• Protect from light

9. Storage & Stability

Lyophilized Powder (Unreconstituted):

• Store at -20°C for long-term stability
• Can store 2-8°C short-term
• Protect from light and moisture
• Stable for years when properly stored

Reconstituted Solution:

• Refrigerate 2-8°C immediately
• Use within 14-30 days (varies by formulation)
• Do not freeze (destroys peptide structure)
• Protect from light (UV degradation)

Topical Formulation:

• Follow product-specific guidelines
• Typically 2-8°C storage
• Shelf life varies by formulation
• Check expiration dates

Peptide Stability: Subject to proteolytic degradation; requires proper cold-chain management for therapeutic efficacy

11. Product Cross-Reference

Core Peptides Equivalent: Product page inaccessible during research; verify availability at https://www.corepeptides.com/product/ll-37/

Typical Research Specifications:

• Form: Lyophilized powder
• Purity: >98% (HPLC)
• Common Sizes: 2mg, 5mg, 10mg vials
• Storage: -20°C

Epiq Aminos: Product availability and pricing to be confirmed via https://orange-shrew-635172.hostingersite.com/

InvivoGen: LL-37/hCAP18 research-grade peptide available from InvivoGen

Compounded Formulations: Some compounding pharmacies may offer LL-37 with physician prescription; legality and quality vary by jurisdiction and pharmacy.

12. References & Citations

1. Cathelicidin Antimicrobial Peptide - Wikipedia
2. Oren Z, et al. LL-37: structure and antimicrobial mechanisms. Biochim Biophys Acta. 2006.
3. InvivoGen - LL-37/hCAP18 Antimicrobial Peptide
4. Ridyard KE, et al. Structure of LL-37 shows oligomerization and channel formation. Sci Rep. 2020.
5. Vandamme D, et al. Human cathelicidin LL-37 - pore-forming peptide and host-cell modulator. Biochim Biophys Acta. 2012.
6. Niyonsaba F, et al. Potential of LL-37 as antimicrobial and anti-biofilm agent. Antibiotics. 2021.
7. Turner J, et al. Antimicrobial and chemoattractant activity of LL-37 analogs. Antimicrob Agents Chemother. 1998.
8. Grönberg A, et al. Treatment with LL-37 enhances healing of hard-to-heal venous leg ulcers. Wound Repair Regen. 2014.
9. Peptide Dosages - LL-37 Dosage Protocol
10. Peptides.org - LL-37 Dosage Calculator
11. Kahlenberg JM, et al. LL-37 enhancement of TLR3 signal transduction. J Biol Chem. 2006.
12. Regen Therapy - LL-37 Legal Status 2025
13. DrugBank - LL-37
14. Swolverine - LL-37 for Beginners

13. Goal Archetype Integration - DEEP Analysis

Primary Goal Alignment

When This Compound Makes Sense - Expanded

Primary Indications (High Evidence)

1. Chronic or Non-Healing Wounds

• Venous leg ulcers: RCT demonstrated 68% ulcer reduction with 0.5 mg/mL topical over 4 weeks
• Diabetic foot ulcers: Impaired endogenous cathelicidin production in diabetes; exogenous LL-37 may compensate
• Surgical wound complications: Post-operative infection prophylaxis and healing acceleration
• Pressure ulcers: Biofilm disruption in chronic wounds
• Burns: Enhanced re-epithelialization and antimicrobial protection

2. Recurrent or Antibiotic-Resistant Infections

• MRSA infections: Effective against methicillin-resistant Staphylococcus aureus both extracellular and intracellular
• Biofilm-forming infections: Chronic sinusitis, chronic prostatitis, catheter-associated infections
• MDR bacterial infections: Multi-drug resistant E. coli, P. aeruginosa, synergistic with polymyxins
• Post-surgical infection prophylaxis: Particularly in high-risk patients (immunocompromised, diabetic, elderly)

3. Immune Dysregulation States

• Immunocompromised patients: Cancer treatment recovery, HIV/AIDS, post-transplant (with careful monitoring)
• Post-viral recovery: COVID-19 recovery, influenza recovery, chronic viral fatigue
• Chronic inflammatory conditions: May reduce excessive inflammation while maintaining antimicrobial defense
• Elderly immune senescence: Age-related decline in endogenous cathelicidin; supplementation may restore antimicrobial capacity

4. Respiratory Tract Infections

• Upper respiratory infections: Broad activity against oral/respiratory pathogens
• Chronic sinusitis: Biofilm disruption in sinus cavities
• Bronchitis (acute and chronic): Antimicrobial and anti-inflammatory effects
• COVID-19 adjunct therapy: May reduce inflammatory responses and microthrombosis

5. Gut Health Applications

• IBD (Inflammatory Bowel Disease): Low serum LL-37 correlates with poor prognosis in IBD; supplementation may modulate inflammation
• Small intestinal bacterial overgrowth (SIBO): Antimicrobial effects on pathogenic overgrowth
• Post-antibiotic microbiome recovery: May help restore balance while preventing opportunistic infections
• Leaky gut syndrome: Supports intestinal barrier integrity

6. Longevity and Healthspan Extension

• Infection resistance in aging: Compensates for age-related decline in endogenous production
• Chronic inflammation reduction: Lower inflammatory burden associated with extended healthspan
• Immune system maintenance: Preserves innate immune function in elderly populations
• Wound healing capacity: Maintains tissue repair capacity that declines with age

Secondary/Investigational Indications (Emerging Evidence)

Skin Conditions:

• Acne vulgaris (topical application)
• Rosacea (anti-inflammatory + antimicrobial)
• Atopic dermatitis (with caution; monitor for exacerbation)

Dental/Oral Health:

• Periodontal disease (antimicrobial mouth rinse)
• Post-dental surgery healing
• Oral candidiasis

Urogenital Infections:

• Chronic UTIs (urinary tract infections)
• Bacterial vaginosis
• Chronic prostatitis

When to Choose Something Else - Expanded

Better Alternatives for Specific Goals

Pure Tissue Regeneration (No Infection Component):

• BPC-157: Superior for musculoskeletal healing, tendon/ligament repair, GI tract healing without infection
• TB-500: Preferred for systemic tissue repair, muscle regeneration, joint health
• GHK-Cu: Better for cosmetic wound healing, anti-aging skin effects

Systemic Immune Modulation:

• Thymosin Alpha-1: Broader immunomodulation; enhances adaptive immunity (T-cell function); better for chronic viral infections, cancer immunotherapy support
• TB-500: Immune modulation + tissue repair without antimicrobial focus

Gut Healing (Primary Goal):

• BPC-157: Superior for non-infectious GI tract healing; ulcers, IBS, leaky gut
• KPV (Lysine-Proline-Valine): Better for colitis, inflammatory bowel conditions with primary inflammatory (not infectious) etiology

Cognitive Enhancement:

• Semax, Selank, Dihexa, NSI-189: Direct nootropic effects
• LL-37 is NOT a cognitive enhancer - indirect benefits only via inflammation reduction

Contraindications and Cautions

Autoimmune Skin Conditions (CAUTION or AVOID):

• Psoriasis: Elevated LL-37 levels (up to 300 µM) observed in psoriatic lesions; may exacerbate
• Rosacea: Mixed evidence; monitor closely if using
• Mechanism: Excessive LL-37 can promote keratinocyte proliferation and inflammation in susceptible individuals

Systemic Lupus Erythematosus (SLE) - POTENTIAL CONTRAINDICATION:

• LL-37 may promote TLR7/9 signaling and autoantibody formation
• May exacerbate lupus flares
• Use ONLY under specialist supervision if considering

Active Malignancy (CAUTION):

• LL-37's role in cancer is complex and context-dependent
• Some evidence suggests it may promote angiogenesis (tumor blood supply)
• Avoid in active cancer without oncologist approval
• May be safe post-remission for infection prevention

Pregnancy/Lactation (INSUFFICIENT DATA - AVOID):

• No safety data in pregnancy
• Unknown transfer to breast milk
• Avoid unless absolutely necessary with OB approval

Goal-Specific Application Strategies

For Immune Optimization (Antimicrobial Effects, Infection Prevention)

Who Benefits:

• Frequent travelers exposed to novel pathogens
• Healthcare workers with high infection exposure
• Immunocompromised individuals
• Elderly with declining immune function
• Athletes with overtraining-induced immune suppression

Protocol:

• Preventive: 75-100 mcg SC 2-3x/week during high-risk periods
• Acute infection: 100-150 mcg SC daily for 7-14 days (see Acute Infection Protocols below)
• Chronic infection: 100 mcg SC 3x/week for 6-8 weeks, then assess
• Stack with: Thymosin Alpha-1 (adaptive immunity), Vitamin D3 5000 IU/day (enhances endogenous cathelicidin)

Success Metrics:

• Reduced infection frequency
• Faster recovery from infections
• Reduced antibiotic usage
• Improved WBC parameters

For Recovery/Healing (Wound Healing, Tissue Repair, Antimicrobial Protection)

Who Benefits:

• Post-surgical patients (especially high infection risk)
• Diabetics with impaired wound healing
• Elderly with slow-healing wounds
• Athletes with skin trauma (mat burns, lacerations)
• Burn victims

Protocol:

• Topical PLUS systemic:
  • Topical: 0.5-1.6 mg/mL applied directly to wound 2x/week
  • Systemic: 100 mcg SC every other day
• Duration: Until wound closure (typically 4-8 weeks)
• Stack with: BPC-157 (tissue repair), GHK-Cu (collagen synthesis)

Success Metrics:

• Faster wound closure (measure wound area weekly)
• Reduced infection rates
• Improved scar quality
• Reduced pain/inflammation

For Longevity (Immune System Health, Infection Resistance)

Who Benefits:

• Ages 50+ (declining endogenous cathelicidin)
• Those focused on healthspan extension
• Individuals with family history of age-related immune decline
• Biohackers optimizing for infection resistance in aging

Protocol:

• Maintenance: 50-75 mcg SC 2x/week (lower dose, longer-term)
• Cycling: 8-12 weeks on, 4-6 weeks off (to prevent downregulation of endogenous production)
• Synergistic support:
  • Vitamin D3: 5000 IU/day (supports endogenous LL-37 expression via VDR pathway)
  • Phenylbutyrate: 500 mg BID (synergistically induces cathelicidin with vitamin D)
  • Vitamin A: Adequate intake (RXR involvement in VDR signaling)

Success Metrics:

• Reduced infection frequency over years
• Maintained WBC parameters with age
• Faster recovery from infections
• Reduced inflammatory markers (CRP, ESR)

For Gut Health (Antimicrobial Effects on Gut Microbiome)

Who Benefits:

• SIBO (small intestinal bacterial overgrowth)
• Post-antibiotic dysbiosis
• IBD patients (with specialist supervision)
• Chronic GI infections resistant to antibiotics

Protocol:

• Oral (if available): Enteric-coated formulation preferred
• Subcutaneous: 75-100 mcg SC 3x/week (systemic absorption affects gut)
• Duration: 4-6 weeks, then reassess
• Stack with: Probiotics (after 2 weeks of LL-37 to repopulate), BPC-157 (if GI healing needed)

Success Metrics:

• Reduced GI symptoms (bloating, pain, diarrhea)
• Improved stool quality
• Breath test improvement (if SIBO)
• Reduced inflammatory markers in stool (calprotectin)

CAUTION: LL-37 is a broad-spectrum antimicrobial - may temporarily disrupt beneficial gut flora. Consider probiotic support after initial treatment phase.

Decision Framework: LL-37 vs Alternatives

14. Age-Stratified Dosing - Immune Function and Aging

Understanding Immunosenescence and LL-37

The Aging Immune System: As we age, the immune system undergoes "immunosenescence" - a gradual deterioration of immune function characterized by:

• Decline in endogenous cathelicidin (LL-37) production
• Reduced neutrophil antimicrobial activity
• Impaired wound healing capacity
• Increased susceptibility to infections
• Chronic low-grade inflammation ("inflammaging")
• Reduced vitamin D receptor (VDR) expression and vitamin D metabolism

Why LL-37 Matters More with Age:

• Elderly individuals show 30-40% lower serum LL-37 levels compared to young adults
• Impaired vitamin D-cathelicidin axis due to reduced vitamin D absorption and VDR expression
• Lower baseline antimicrobial peptide production in epithelial tissues
• Exogenous LL-37 may partially compensate for age-related decline

Age-Stratified Dosing Guidelines

Age-Specific Considerations by Decade

Ages 20-35: Optimal Immune Function

Physiology:

• Peak immune system performance
• High endogenous LL-37 production
• Efficient vitamin D metabolism
• Robust wound healing capacity

Dosing Strategy:

• Use standard protocols without modification
• Consider LL-37 primarily for acute infections, wound healing, or specific immune challenges
• Less likely to need long-term immune support unless immunocompromised

Monitoring:

• Standard monitoring sufficient
• Baseline labs before starting
• Follow-up at 4-6 weeks if chronic use

Ages 35-50: Early Immune Transition

Physiology:

• Beginning of subtle immune decline (not usually clinically significant)
• Vitamin D levels may start declining (especially with reduced sun exposure)
• Endogenous LL-37 production still adequate for most individuals
• Recovery from infections may be slightly slower than in 20s

Dosing Strategy:

• Standard dosing remains appropriate
• Monitor vitamin D status - supplement if <30 ng/mL
• Consider LL-37 for recurrent infections, slow wound healing, or immune optimization

Monitoring:

• Baseline vitamin D testing recommended
• Standard CBC, CRP monitoring
• More attention to recovery patterns

Ages 50-65: Accelerating Immunosenescence

Physiology:

• Measurable decline in endogenous cathelicidin production
• Vitamin D deficiency more common (reduced skin synthesis, absorption issues)
• Increased infection susceptibility
• Slower wound healing
• Emerging "inflammaging" (chronic low-grade inflammation)

Dosing Strategy:

• Start lower (75 mcg) and titrate based on response
• Maximum doses typically 150 mcg (vs 200 mcg in younger adults)
• Critical: Address vitamin D deficiency FIRST
  • Vitamin D3: 5000 IU/day (target serum level >40 ng/mL)
  • Phenylbutyrate: 500 mg BID (synergistically induces cathelicidin with vitamin D)
• Shorter cycles (6-8 weeks) with adequate washout (4 weeks)

Monitoring:

• Mandatory vitamin D testing (baseline and on-treatment)
• CBC with differential every 4 weeks (watch for WBC changes)
• CRP/ESR to assess inflammatory burden
• Consider immune panel if recurrent infections

Synergistic Support:

• Vitamin D3 + K2 (for calcium metabolism)
• Zinc (15-30 mg/day) - supports immune function
• Adequate protein intake (1.0-1.2 g/kg) - supports antibody production

Ages 65+: Significant Immunosenescence

Physiology:

• 30-40% reduction in serum LL-37 levels compared to young adults
• Marked vitamin D deficiency common (>70% of elderly are deficient)
• Impaired neutrophil function
• Chronic inflammation (inflammaging)
• Slower drug clearance (reduced renal/hepatic function)
• Increased risk of adverse reactions

Dosing Strategy:

• Start low (50 mcg), go slow
• Maximum doses: 125 mcg (avoid higher doses due to clearance concerns)
• Frequency: 2-3x/week (vs daily or EOD in younger patients)
• Shorter cycles: 4-6 weeks (vs 8-12 weeks)
• Longer washouts: 4-6 weeks (allow recovery of endogenous production)
• Mandatory vitamin D optimization:
  • Vitamin D3: 5000-7000 IU/day (elderly need higher doses for same serum levels)
  • Target serum 25-OH vitamin D: 50-70 ng/mL
  • Phenylbutyrate: 500 mg BID

Monitoring:

• Baseline: Comprehensive metabolic panel (CMP), CBC with differential, vitamin D, CRP, ESR
• 2 weeks: CBC (watch for early reactions)
• 4 weeks: Full panel (CMP, CBC, CRP)
• 6 weeks: Repeat if continuing
• More frequent injection site monitoring (elderly skin is more fragile)

Synergistic Support (Critical for Elderly):

• Vitamin D3 + K2: Essential (most important co-intervention)
• Zinc: 15 mg/day (higher doses can impair copper absorption in elderly)
• Protein: 1.2-1.5 g/kg (elderly need more protein for immune function)
• Consider Thymosin Alpha-1 stack (enhances adaptive immunity in elderly)

Special Considerations for Elderly:

• Higher risk of polypharmacy interactions (see Drug Interactions section)
• More likely to be on immunosuppressants (for autoimmune conditions, post-transplant)
• Skin fragility - rotate injection sites carefully, smaller gauge needles
• Renal function often reduced - monitor for slower clearance
• May have undiagnosed autoimmune conditions (psoriasis, lupus) - screen carefully

Weight-Based Dosing Alternative (All Ages)

Alternative to age-stratified fixed dosing: 50 mcg/kg body weight per day

CAUTION: Weight-based dosing often exceeds typical fixed-dose protocols. This dosing strategy is derived from animal studies and may not translate directly to humans. Start conservatively (lower end of range) and titrate based on tolerability and response.

For elderly (65+) using weight-based approach:

• Reduce calculated dose by 30-40%
• Example: 75 kg elderly patient → 3,750 mcg × 0.6 = 2,250 mcg/day (2.25 mg)
• This is higher than standard elderly dosing (50-125 mcg) - use with caution

Frequency Adjustments by Age

Vitamin D Co-Supplementation by Age (CRITICAL)

Why Vitamin D Matters for LL-37:

• Vitamin D induces cathelicidin expression via VDR (vitamin D receptor)
• Synergistic effect: Exogenous LL-37 + endogenous production (from vitamin D) = enhanced efficacy
• Vitamin D deficiency is EXTREMELY common in elderly (>70%)

Phenylbutyrate Addition (Optional but Synergistic):

• Phenylbutyrate synergistically induces cathelicidin when combined with vitamin D
• Dose: 500 mg twice daily (BID)
• All age groups benefit, but especially 50+ where endogenous production is declining
• Mechanism: Histone deacetylase (HDAC) inhibitor; enhances VDR-mediated gene transcription

Cycle Duration and Washout by Age

Why Cycling Matters:

• Prevent downregulation of endogenous cathelicidin production
• Allow natural immune recovery
• Reduce risk of tolerance or reduced efficacy
• Minimize long-term side effect risk

Continuous Use Caution:

• DO NOT exceed 3 months continuous treatment at maximum doses (any age)
• For elderly: Prefer shorter cycles (4-6 weeks) with longer washouts
• Exception: Active infection requiring prolonged treatment - reassess weekly

Sex-Specific Considerations

Males:

• Standard dosing protocols apply across all age brackets
• No significant sex-based pharmacokinetic differences documented in available literature
• Monitor for injection site reactions equally
• Endogenous LL-37 production does not appear to be significantly influenced by testosterone levels
• May have slightly higher baseline LL-37 levels due to generally higher muscle mass and metabolic activity

Females:

• Standard dosing protocols apply across all age brackets
• Pregnancy: INSUFFICIENT SAFETY DATA - AVOID USE
  • No human studies in pregnancy
  • Unknown effects on fetal development
  • Unknown placental transfer
  • Use ONLY if benefit clearly outweighs unknown risks (life-threatening infection) with OB approval
• Lactation: INSUFFICIENT SAFETY DATA - AVOID USE
  • Unknown transfer to breast milk
  • Unknown effects on nursing infant
  • Theoretical risk of altering infant's developing immune system
• Hormonal cycle considerations:
  • No documented direct interactions with menstrual cycle phases
  • Some evidence that estrogen may influence cathelicidin expression (mechanism unclear)
  • No dose adjustments needed based on cycle phase
• Menopause:
  • Post-menopausal women may have slightly reduced endogenous LL-37 production (related to estrogen decline)
  • Consider standard age-based dosing (typically 50+ bracket)
  • Vitamin D supplementation especially important (bone health + cathelicidin production)
• Autoimmune disease prevalence:
  • Females have higher rates of autoimmune conditions (SLE, psoriasis, RA, etc.)
  • Screen carefully for psoriasis, lupus before initiating LL-37
  • Monitor for autoimmune exacerbation if family history present

Pregnancy Category: NOT ASSIGNED (investigational compound; no FDA pregnancy category)

14b. Acute Infection Protocols - Dosing for Active Infections

Understanding LL-37 in Acute Infections

Critical Distinction:

• Preventive/Maintenance dosing: 50-100 mcg SC 2-3x/week (supports baseline immune function)
• Acute infection dosing: 100-200 mcg SC daily for 7-14 days (aggressive antimicrobial effect)

Mechanism During Acute Infection:

• Direct antimicrobial effect via membrane disruption occurs rapidly (hours)
• Biofilm disruption enhances antibiotic penetration
• Immunomodulatory effects reduce excessive inflammation while maintaining pathogen clearance
• Synergistic with conventional antibiotics - may allow reduced antibiotic doses

Acute Infection Dosing by Type

Respiratory Tract Infections (RTIs)

Upper Respiratory Infections (Common Cold, Pharyngitis):

• Dose: 100 mcg SC once daily
• Duration: 7-10 days (or until symptom resolution + 2 days)
• Frequency: Daily dosing (vs 3x/week maintenance)
• Adjunct therapy:
  • Vitamin C: 2000 mg/day (immune support)
  • Zinc lozenges: 15-30 mg/day (upper respiratory antimicrobial)
  • Adequate hydration and rest
• Expected timeline:
  • Symptom improvement: 24-48 hours
  • Full resolution: 5-7 days (vs 10-14 days untreated)

Acute Sinusitis:

• Dose: 100-150 mcg SC once daily
• Duration: 10-14 days (biofilm disruption requires sustained dosing)
• Topical adjunct: Saline nasal rinse (flushes debris, enhances LL-37 access)
• Consider: Intranasal LL-37 (if available) for direct application to sinus mucosa
• Antibiotic decision: May delay antibiotic initiation 3-5 days; add if no improvement

Acute Bronchitis:

• Dose: 100-150 mcg SC once daily
• Duration: 7-10 days
• Watch for: Progression to pneumonia (fever >101°F, SOB, hypoxia)
• Antibiotic combination: If bacterial (productive colored sputum, high fever), combine with conventional antibiotics

COVID-19 or Viral Respiratory Infection:

• Dose: 100 mcg SC once daily
• Duration: 10-14 days (or until symptom resolution + 3 days)
• Rationale: May reduce inflammatory responses and microthrombosis
• Stack with: Thymosin Alpha-1 (1.6 mg SC 3x/week for adaptive immune support)
• Monitor: SpO2, fever, progression of symptoms

Skin and Soft Tissue Infections (SSTIs)

Cellulitis:

• Dose: 150 mcg SC once daily (higher dose for aggressive infection)
• Duration: 10-14 days
• CRITICAL: Combine with oral antibiotics (LL-37 is ADJUNCT, not replacement)
• Topical: If available, apply LL-37 0.5-1.6 mg/mL gel directly to affected area
• Monitor: Red streaking (lymphangitis), fever, spreading erythema
• Success metric: Reduction in erythema border by day 3-5

Abscess (Post-Drainage):

• Dose: 100 mcg SC once daily
• Duration: 7-10 days (continue until wound fully closed)
• Topical: LL-37 gel applied directly to packed wound site 1-2x/day
• Packing changes: Daily, with LL-37 gel application
• Antibiotic: Usually not needed if properly drained; add if surrounding cellulitis

Infected Surgical Wound:

• Dose: 100-150 mcg SC once daily
• Duration: 14 days (surgical wounds require longer treatment)
• Topical: 0.5-1.6 mg/mL LL-37 gel to wound bed after cleaning
• Culture: Obtain wound culture before starting (guides antibiotic choice if needed)
• Debridement: May be required; LL-37 does not replace surgical management
• Monitor: Purulent drainage, wound dehiscence, systemic signs

MRSA Skin Infection:

• Dose: 150-200 mcg SC once daily (maximum dose for resistant organism)
• Duration: 14 days minimum
• CRITICAL: LL-37 effective against MRSA but use WITH conventional anti-MRSA antibiotics (vancomycin, daptomycin, linezolid)
• Decolonization: Consider mupirocin nasal ointment + chlorhexidine body washes
• Repeat cultures: At 7 days to confirm clearance

Urogenital Infections

Acute Urinary Tract Infection (UTI):

• Dose: 100 mcg SC once daily
• Duration: 7 days (uncomplicated), 10-14 days (complicated)
• Antibiotic: May try LL-37 alone for 48 hours (uncomplicated); add antibiotic if no improvement or if pyelonephritis suspected
• Hydration: Critical - 2-3 L water/day
• Monitor: Fever (>101°F suggests pyelonephritis), flank pain, nausea
• D-mannose: 2g BID as adjunct (prevents E. coli adherence to bladder wall)

Recurrent UTIs (Prophylaxis):

• Dose: 75 mcg SC 2-3x/week
• Duration: 3-6 months (then reassess)
• Goal: Reduce frequency of recurrences (NOT acute treatment)
• Track: UTI frequency before and during LL-37 prophylaxis

Bacterial Vaginosis:

• Dose: 100 mcg SC once daily
• Duration: 7-10 days
• Topical (if available): Intravaginal LL-37 gel (experimental)
• Conventional treatment: Metronidazole or clindamycin first-line; LL-37 as adjunct
• Probiotics: Add after completion (Lactobacillus suppositories to restore flora)

Chronic Prostatitis:

• Dose: 100 mcg SC 3x/week (chronic dosing, not daily)
• Duration: 8-12 weeks (chronic condition requires extended treatment)
• Antibiotic: Fluoroquinolone for 4-6 weeks if bacterial; LL-37 may help with biofilm disruption
• Alpha-blocker: Tamsulosin for symptom relief (urinary symptoms)
• Reassess: At 4 weeks; continue if improving

Gastrointestinal Infections

Acute Gastroenteritis (Bacterial):

• Dose: 100 mcg SC once daily
• Duration: 5-7 days
• CAUTION: May transiently worsen diarrhea (gut flora disruption)
• Hydration: Critical - oral rehydration solution
• Consider: Stool culture if severe, bloody, or prolonged (>3 days)
• Probiotics: After 3-5 days of LL-37 (repopulate beneficial bacteria)

Small Intestinal Bacterial Overgrowth (SIBO):

• Dose: 75-100 mcg SC 3x/week
• Duration: 4-6 weeks
• Adjunct: Rifaximin (antibiotic) for 14 days + LL-37 for biofilm disruption
• Breath test: Hydrogen/methane breath test at baseline and 4 weeks post-treatment
• Probiotics: After treatment completion
• Diet: Low-FODMAP during treatment

C. difficile Infection (Adjunct):

• Dose: 100 mcg SC once daily
• Duration: 14 days (concurrent with oral vancomycin or fidaxomicin)
• CRITICAL: LL-37 is ADJUNCT only - NOT a replacement for standard C. diff treatment
• Rationale: May reduce inflammation and support gut barrier integrity
• FMT consideration: Fecal microbiota transplant if recurrent C. diff

Biofilm-Associated Infections (Chronic)

Chronic Sinusitis with Biofilm:

• Dose: 100 mcg SC 3x/week
• Duration: 8-12 weeks
• Rationale: Biofilm disruption requires sustained dosing
• Adjunct: Nasal saline irrigation with baby shampoo (surfactant disrupts biofilm)
• Antibiotic: Prolonged course (4-6 weeks) with biofilm-penetrating agent (azithromycin)
• Surgery: May be required if medical management fails

Catheter-Associated UTI:

• Dose: 100 mcg SC once daily
• Duration: 7-10 days
• CRITICAL: Remove or change catheter if possible
• Antibiotic: Based on culture and sensitivity
• Biofilm: Catheter biofilms are difficult to eradicate; LL-37 may help but catheter removal is key

Chronic Wound with Biofilm:

• Dose: 100 mcg SC 3x/week
• Duration: 4-8 weeks (until wound closure)
• Topical: 0.5-1.6 mg/mL LL-37 gel to wound bed 2x/week
• Debridement: May require sharp or enzymatic debridement to remove biofilm
• Wound VAC: Negative pressure therapy may enhance LL-37 penetration

Antibiotic Synergy and Timing

Synergistic Antibiotics (Use Together):

• Polymyxins (Colistin, Polymyxin B): Strong synergy against MDR Gram-negatives
• Beta-lactams (Penicillins, Cephalosporins): Additive/synergistic
• Fluoroquinolones (Ciprofloxacin, Levofloxacin): Additive
• Aminoglycosides (Gentamicin, Tobramycin): Additive

Potentially Antagonistic Antibiotics (AVOID concurrent use):

• Bacteriostatic antibiotics (Tetracyclines, Macrolides, Sulfonamides): May trigger efflux pumps that reduce LL-37 efficacy
• If bacteriostatic antibiotic is necessary, separate administration by 6-12 hours

Timing with Antibiotics:

• Administer LL-37 SC in morning
• Administer antibiotics per prescribed schedule
• No need to separate by hours (except bacteriostatic agents)

Monitoring During Acute Infection

Clinical Monitoring:

• Temperature: Daily (fever curve should trend downward by 48-72 hours)
• Symptom severity: Track on 0-10 scale daily
• Vital signs: If severe infection (HR, BP, RR, SpO2)
• Wound measurements: If SSTI (photograph weekly, measure erythema border)

Laboratory Monitoring:

• Baseline: CBC with differential, CRP (or procalcitonin if severe)
• Day 3-5: Repeat if severe infection or immunocompromised
• Day 7-10: Repeat CBC, CRP to assess response
• Expected changes:
  • WBC: Should normalize or trend toward normal
  • CRP: Should decrease by ≥50% by day 7 if responding
  • Procalcitonin: Should decrease rapidly if bacterial infection resolving

Red Flags Requiring Immediate Medical Attention:

• Fever >103°F (39.4°C) or persistent fever >101°F beyond 72 hours
• Hemodynamic instability (low BP, tachycardia)
• Altered mental status
• Spreading erythema despite treatment (cellulitis/abscess)
• Respiratory distress (pneumonia)
• Oliguria (kidney infection/sepsis)

Transition from Acute to Maintenance Dosing

When Infection is Resolving:

• Acute phase: 100-150 mcg SC daily × 7-14 days
• Transition: Reduce to 100 mcg SC every other day × 1 week
• Maintenance (if needed): 75 mcg SC 3x/week × 4-6 weeks
• Discontinue: Taper over 1-2 weeks, then monitor

Indications for Maintenance Dosing Post-Infection:

• Recurrent infections (≥3 per year)
• Immunocompromised state
• Chronic wound healing
• Biofilm-associated chronic infection

Pediatric Considerations (Acute Infection)

CAUTION: Limited data in pediatrics

If considering pediatric use (with specialist approval):

• Weight-based dosing: 50 mcg/kg/day divided into 1-2 doses
• Maximum: 100 mcg/day regardless of weight
• Duration: Same as adults for specific infection
• Only for severe, resistant infections not responding to conventional therapy

Practical Biohacker Acute Infection Protocol

Scenario: Early Upper Respiratory Infection

Day 1 (Onset of Symptoms):

• LL-37: 100 mcg SC (abdomen or thigh)
• Vitamin C: 2000 mg
• Zinc: 30 mg
• Vitamin D3: 10,000 IU (loading dose)
• Hydration: 3+ liters water
• Rest: Cancel non-essential activities

Days 2-7:

• LL-37: 100 mcg SC daily (same time each day)
• Vitamin C: 1000 mg BID
• Zinc: 15-30 mg/day
• Vitamin D3: 5000 IU/day
• Hydration: 2-3 liters water
• Sleep: Prioritize 8-9 hours

Day 3 Assessment:

• Symptoms improving? → Continue protocol
• Symptoms same or worse? → Consider adding antibiotic (see physician)
• Fever >101°F? → Medical evaluation recommended

Days 8-10 (Symptom Resolution):

• LL-37: Reduce to 100 mcg SC every other day
• Maintain vitamins
• Gradual return to normal activity

Post-Resolution (Optional Maintenance):

• LL-37: 75 mcg SC 2x/week for 2-4 weeks
• Supports full immune recovery
• Reduces risk of secondary infection

Weight-Based Dosing Option

Alternative to fixed dosing: 50 mcg/kg body weight per day

Note: Weight-based dosing may exceed typical fixed-dose protocols. Start conservatively and titrate based on tolerability.

15. Drug Interactions - Comprehensive

Prescription Medications

Other Peptides (Stacking Considerations)

Supplements

Foods/Timing

16. Bloodwork Impact & Monitoring

Expected Marker Changes

Monitoring Schedule

Red Flags in Labs

Labs + Symptoms Integration

Marker-Based Dose Adjustment

Adjustment by Baseline Markers

Adjustment by Response Markers

17. Protocol Integration

Stacking with Other Compounds

Common Stacks

Timing Considerations

Integration with Pillars

Protocol Examples

Chronic Wound Healing Protocol (8 weeks)

Week 1-2 (Loading):

• LL-37: 100 mcg SC every other day
• BPC-157: 250 mcg SC daily (near wound site)
• Vitamin D3: 5000 IU oral daily

Week 3-8 (Maintenance):

• LL-37: 100 mcg SC 3x/week
• BPC-157: 250 mcg SC daily
• Vitamin D3: 5000 IU oral daily

Topical adjunct: LL-37 0.5 mg/mL gel applied directly to wound 2x weekly

Immune Support Protocol (6 weeks)

Week 1-6:

• LL-37: 75-100 mcg SC 3x/week
• Thymosin Alpha-1: 1.6 mg SC 2x/week
• Vitamin D3: 5000 IU oral daily
• Zinc: 30 mg oral daily

Washout: 4 weeks minimum before repeating cycle

Post-Infection Recovery Protocol (4 weeks)

Week 1-4:

• LL-37: 100 mcg SC every other day
• TB-500: 2.5 mg SC 2x/week (loading first 2 weeks), then weekly
• BPC-157: 250 mcg SC daily
• Vitamin D3: 5000 IU oral daily

Document Version: 2.0 Last Updated: January 5, 2026 Development Status: Investigational; Phase I/II Clinical Trials Regulatory Status: NOT FDA-Approved; Research Chemical Only Enhancement: Goal archetypes, age-stratified dosing, comprehensive drug interactions, bloodwork monitoring, protocol integration added per ENHANCEMENT-TEMPLATE.md